PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_018270-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 204aa    MW: 23165.3 Da    PI: 8.9625
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_018270-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY95.24.7e-30142200159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDg++W+KYG+K+vk++++pr+Y+rC+ +gCpvkk++er+a+dp+ v++tYeg+Hnhe
  NNU_018270-RA 142 LDDGFKWKKYGKKMVKNKPYPRNYFRCSVEGCPVKKRIERDADDPRHVITTYEGTHNHE 200
                    59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.6E-32130202IPR003657WRKY domain
SuperFamilySSF1182904.18E-27136202IPR003657WRKY domain
PROSITE profilePS5081130.481137202IPR003657WRKY domain
SMARTSM007741.3E-32142201IPR003657WRKY domain
PfamPF031069.6E-24143200IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MNIAQNLSID IEMSNRHPTP AGISPEKISH HLLNFELPDY LDLNQWFEGD TASVTHGSSN  60
QDLILPMPNI VGSGKNGSQA EVSSPSNMQC YFLLCAALEF SFFSVSIKTG ICFHVVRGRR  120
SRTRNSVLAR VAFRIKTEKD ILDDGFKWKK YGKKMVKNKP YPRNYFRCSV EGCPVKKRIE  180
RDADDPRHVI TTYEGTHNHE SPFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-26132202777Probable WRKY transcription factor 4
1wj2_A2e-26132202777Probable WRKY transcription factor 4
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00531DAPTransfer from AT5G26170Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010273969.11e-124PREDICTED: probable WRKY transcription factor 50
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.19e-42WRKY DNA-binding protein 50